Vergleich

Human Glucagon like peptide 2 (GLP2) ELISA Kit

Hersteller Abbkine Scientific
Kategorie
Typ Elisa-Kit
Specific against Human
Applikationen ELISA
Menge 96Tx50
ArtNr ABK-KTE62531-96Tx50
Targets GCG
eClass 6.1 32160605
eClass 9.0 32160605
Lieferbar
Applications notes
This Human Glucagon like peptide 2 (GLP2) ELISA Kit employs a two-site sandwich ELISA to quantitate GLP2 in samples. An antibody specific for GLP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GLP2 is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Detection method
Colorimetric
Sample type
Cell culture supernatants#Serum#Plasma#Other biological fluids
Assay type
Sandwich ELISA (quantitative)
Assay duration
Multiple steps standard sandwich ELISA assay with a working time of 3-5 hours. It depends on the experience of the operation person.
Kit components

Human Glucagon like peptide 2 microplate
Human Glucagon like peptide 2 standard
Human Glucagon like peptide 2 detect antibody
Streptavidin-HRP
Standard diluent
Assay buffer
HRP substrate
Stop solution
Wash buffer
Plate covers
Features & Benefits
Human Glucagon like peptide 2 (GLP2) ELISA Kit has high sensitivity and excellent specificity for detection of Human GLP2. No significant cross-reactivity or interference between Human GLP2 and analogues was observed.
Usage notes
Do not mix components from different kit lots or use reagents beyond the kit expiration date.
Allow all reagents to warm to room temperature for at least 30 minutes before opening.
Pre-rinse the pipet tip with reagent, use fresh pipet tips for each sample, standard and reagent to avoid contamination.
Unused wells must be kept desiccated at 4 C in the sealed bag provided.
Mix Thoroughly is very important for the result. It is recommended using low frequency oscillator or slight hand shaking every 10 minutes.
It is recommended that all samples and standards be assayed in duplicate or triplicate.
Storage instructions
The unopened kit should be stored at 2 - 8C. After opening, please store refer to protocols.
Shipping
Gel pack with blue ice.
Precautions
The product listed herein is for research use only and is not intended for use in human or clinical diagnosis. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license. We cannot be responsible for patent infringements or other violations that may occur with the use of this product.
Background
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Alternative
GLP2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 96Tx50
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 13.06.2024 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen