Vergleich

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6), CF405S conjugate, 0.1mg/mL

ArtNr B-BNC040316-100
Hersteller Biotium
Menge 100 uL
Quantity options 100 uL 500 uL
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen IHC
Clon 2F6
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a Kappa
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias MEKK1,MEK Kinase 1,MEKK,SRXY6,MAPKKK1
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Primary
Manufacturer - Applications
IHC, FFPE (verified)
Manufacturer - Category
Primary Antibodies Only
Manufacturer - Targets
MAP3K1
Manufacturer - Conjugate / Tag
CF405S
Manufacturer - Host
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Shipping Temperature
Room Temperature (Next day)
Storage Conditions
Store at 2 to 8°C|Protect fluorescent conjugates from light
Molecular Weight
195 kDa (intact); 80 kDa (cleaved)
Description
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Product origin
Animal
Ingredient of biological origin
Mus musculus (mouse), BSA from bovine serum (Bos taurus) or recombinant BSA produced in Chinese hamster ovary cells.
Special handling for PI and label
Protect from light
Undated stability guarantee in PI
2 years
Stability at RT during shipping (protected from light)
Stable at room temperature or 37°C (98°F) for 7 days.
UNSPSC Commodity
41116161
UNSPSC Commodity Title
Primary and secondary antibodies for multiple methodologyimmunostaining detection application
Classified or regulated chemicals
0.05% sodium azide (CAS 26628-22-8)
Concentration
0.1 mg/mL
Storage buffer
PBS, 0.1% BSA, 0.05% azide
Dated shelf life printed on label
Guaranteed for at least 24 months from date of receipt when stored as recommended
Immunogen (Secondaries, for anti tag only)
Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Clonality
Monoclonal
Regulatory Status
For research use only (RUO)
Human Gene Symbol
MAP3K1
Unigene
653654
Positive Control
A431, HeLa or HL-60 cells. Liver tissue.
Antibody target cellular localization
Cytoplasmic
Antibody applications
IHC, FFPE (verified)
Verified antibody applications
IHC (FFPE) (verified)
Antibody application notes
Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody|Immunohistochemistry (formalin-fixed): 1-2 ug/mL for 30 minutes at RT|Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris buffer with 1 mM EDTA pH 9.0 for 10-20 minutes followed by cooling at RT for 20 minutes|Western Blot 0.5-1 ug/mL|Optimal dilution for a specific application should be determined by user
Manufacturer - Antibody Reactivity
MAP3K1
Antibody number
#0316

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?