Fnbp1 antibody - N-terminal region (ARP40800_P050)

Hersteller AVIVA Systems Biology
Kategorie
Typ Antibody Polyclonal
Specific against Human, Mouse, Rat, Rabbit, Fish, Guinea Pig, Bovine, Canine, Equine
Format Lyophilized powder
Applikationen WB
Menge 50ug
Host Rabbit
ArtNr ARP40800_P050
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Description
This is a rabbit polyclonal antibody against Fnbp1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (infohoelzel.de).
Gene symbol
Fnbp1
Alias symbols
1110057E06Rik, 2210010H06Rik, FBP1, Fbp17
Protein size
522
Molecular weight
57kDa
Gene_id
14269
Peptide Sequence
ENMTSQITVDLMRYVQELKQERKSNFHDGRKAQQH IETCWKQLESSKRRF
Reconstitution and storage
Add 50 ul of distilled water. Final anti-Fnbp1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Partner proteins
Pde6g
Description of target
The function of this protein remains unknown.
Homology short
Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea pig, Horse, African clawed frog
Menge: 50ug
Lieferbar: In stock
Listenpreis: 311,54 €
Preis: 311,54 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen