Zbtb43 antibody - C-terminal region (ARP39048_P050)

Hersteller AVIVA Systems Biology
Kategorie
Typ Antibody Polyclonal
Specific against Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Equine
Format Lyophilized powder
Applikationen WB
Menge 50ug
Host Rabbit
ArtNr ARP39048_P050
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Description
This is a rabbit polyclonal antibody against Zbtb43. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (infohoelzel.de).
Gene symbol
Zbtb43
Alias symbols
1700010E06Rik, Zfp297b, mKIAA0414
Protein size
504
Molecular weight
57kDa
Gene_id
71834
Peptide Sequence
HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTK SYEAAKAEQNTTEAN
Reconstitution and storage
Add 50 ul of distilled water. Final anti-Zbtb43 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Partner proteins
Gtf2e1, Pou5f1
Description of target
Zbtb43 may be involved in transcriptional regulation.
Homology short
Bovine, Dog, Guinea pig, Horse, Human, Mouse, Rabbit, Rat, Chicken
Menge: 50ug
Lieferbar: In stock
Listenpreis: 311,54 €
Preis: 311,54 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen