NAGPA (N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase) Blocking Peptide (the N terminal of NAGPA)(100ug)

Hersteller AVIVA Systems Biology
Kategorie
Typ Peptides
Specific against other
Format Lyophilized powder
Menge 100ug
ArtNr AAP47241
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
description
This is a synthetic peptide designed for use in combination with anti-NAGPA Antibody (ARP47241_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
gene_symbol
NAGPA
nucleotide_accession_num
http://www.ncbi.nlm.nih.gov/nuccore/NM_016256
protein_accession_num
http://www.ncbi.nlm.nih.gov/protein/NP_057340
swissprot_id
http://www.uniprot.org/uniprot/Q9UK23
protein_size
515
molecular_weight
53kDa
product_format
Lyophilized powder
gene_id
51172
peptide_sequence
GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF
reconstitution_and_storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
description_of_target
Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. This reaction most likely occurs in the trans-Golgi network. This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide, the protein's C-terminus contains multiple signals for trafficking it between lysosomes, the plasma membrane, and trans-Golgi network.
Menge: 100ug
Lieferbar: In stock
Listenpreis: 106,72 €
Preis: 106,72 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen