Recombinant human TRAF family member-associated NF-kappa-B activator (OPCA01309)

Kein Verkauf an Patienten, Ärzte, Apotheken oder Privatpersonen! Mehr erfahren

Wie zu jedem Jahresbeginn werden die Preise unserer Produkte aktualisiert. Bestellen Sie gerne trotzdem den gewünschten Artikel. Bei Preisabweichungen wird Sie unser Sales-Team binnen eines Werktages kontaktieren.

Aufgrund von Preisänderungen zum Jahreswechsel, kann es vorkommen, dass Preise teilweise noch nicht sichtbar sind. Stellen Sie gerne eine Angebotsanfrage. Vielen Dank für Ihr Verständnis.

Hersteller AVIVA Systems Biology
Kategorie
Typ Proteins
Specific against other
Menge 10ug
ArtNr OPCA01309
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Gene symbol
TANK
Alias symbols
ITRAF, TRAF2, I-TRAF,
Gene_id
10010
Peptide sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTE NYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQD NNYGCVPLLEDSETRKNNLTLDQPQDKVISGIARE KLPKVDIASAESSI
Reconstitution and storage
Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Description of target
Recombinant human TRAF family member-associated NF-kappa-B activator
Purity
>90% (SDS-PAGE)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 10ug
Lieferbar: Out of stock
Fragen zum Produkt?
 
Schließen