« Zurück
Startseite /
Human recombinant CD326 protein, AF

Human recombinant CD326 protein, AF

ArtNr	BOS-PROTP16422-4-20ug
Hersteller	Boster
Menge	20 ug
Quantity options	100 ug 20 ug 5 ug
Kategorie	Cell Culture
Format	Lyophilized
Applikationen	Cell Culture
Specific against	Human (Homo sapiens)
Konjugat/Tag	HIS
Sequence	MQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK with polyhi
Alias	EPCAM,DIAR5,EGP-2,EGP314,EGP40,ESA,HNPCC8,KS1/4,KSA,M4S1,MIC18,MK-1,TACSTD1,TROP1
Lieferbar
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 28.36 kDa. The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 28.36 kDa.The protein migrates as 30 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	EPCAM
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Human CD326 also called epithelial cellular adhesion molecule (EpCAM), which is a 28 kDa protein containing 242 amino acid residues. Human CD326 is a transmembrane glycoprotein, which is a marker of cancer. CD326 induces the expression of c-myc, cyclins A & E and e-fabp which is involved the cancer cell proliferation and migration.
Bioactivity/Biological Activity	Measure by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED₅₀ for this effect is 0.2-1.7 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-PROTP16422-4-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 04.12.2025