Antibodies

Anti-SRI Antibody

Hersteller Boster
Kategorie
Typ Antibody Polyclonal
Specific against other
Isotype IgG
Format Lyophilized
Applikationen WB, IHC
Menge 100ug/vial
ArtNr BOS-A00222
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Description short
Rabbit IgG polyclonal antibody for SR1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Specificity
No cross reactivity with other proteins.
Application details
Western blot|0.1-0.5μ g/ml
Immunohistochemistry(Paraffin-embedded Section)|0.5-1μ g/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence of human SRI(TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage
At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background
Sorcin is a protein that in humans is encoded by the SRI gene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
Gene name
SRI
Protein name
Sorcin
Gene full name
sorcin
Synonyms
Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI
Uniprot
P30626
Entrez gene id
6717
Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 280,01 €
Preis: 280,01 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen