
Anti-SRI Antibody

Hersteller Boster
Typ Antibody Polyclonal
Specific against other
Isotype IgG
Format Lyophilized
Applikationen WB, IHC
Menge 100ug/vial
ArtNr BOS-A00222
eClass 6.1 32160702
eClass 9.0 32160702
Description short
Rabbit IgG polyclonal antibody for SR1 detection. Tested with WB, IHC-P in Human; Mouse; Rat.
No cross reactivity with other proteins.
Application details
Western blot|0.1-0.5μ g/ml
Immunohistochemistry(Paraffin-embedded Section)|0.5-1μ g/ml
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
A synthetic peptide corresponding to a sequence of human SRI(TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen affinity purified.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
At -20C for one year. After reconstitution, at 4C for one month. It can also be aliquotted and stored frozen at -20C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Sorcin is a protein that in humans is encoded by the SRI gene. It is mapped to 7q21.1. This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
Gene name
Protein name
Gene full name
Sorcin; 22 kDa protein; CP-22; CP22; V19; SRI
Entrez gene id

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 280,01 €
Preis: 280,01 €


Angebot anfordern

Fragen zum Produkt?