Antibodies

Anti-NR0B1 Antibody

Hersteller Boster
Kategorie
Typ Antibody
Specific against other
Applikationen WB, IHC
Menge 100ul
Host Rabbit
ArtNr BOS-A01521
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Gene name
NR0B1
Clonality
Polyclonal
Conjugate
No
Contents
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description
Rabbit Polyclonal antibody for NR0B1 detection. Tested positive for IHC, WB in Human, Mouse, Rat
Uniprot ID
Q9BG96
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NR0B1 Synthetic peptide QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ
Purification
Affinity Purified
Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application details
Dilution ratios see validation images
Reactivity
Human, Mouse, Rat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

 
Schließen