Antibodies

Anti-Human CCKBR DyLight 488 conjugated Antibody

Hersteller Boster
Kategorie
Typ Antibody Primary
Specific against other
Isotype IgG
Format Liquid
Applikationen FC
Menge 100ug/vial
Host Rabbit
ArtNr BOS-A01677-Dyl488
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Clonality
Polyclonal
Description short
Rabbit IgG Polyclonal Anti-Human CCKBR Antibody DyLight 488 Conjugated, Flow Validated.
Specificity
No cross reactivity with other proteins.
Reactivity
Reacts with: human
Application details
Flow Cytometry|1-3ug/1x106 cells
Notes
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification
Immunogen affinity purified.
Storage
At 2-8C for one year. Protect from light. Do not freeze.
Background
The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Reference
1. Altar CA, Boyar WC (Apr 1989). "Brain CCK-B receptors mediate the suppression of dopamine release by cholecystokinin". Brain Research. 483 (2): 321–6.
2. Noble F, Roques BP (Jul 1999). "CCK-B receptor: chemistry, molecular biology, biochemistry and pharmacology". Progress in Neurobiology. 58 (4): 349–79.
Gene Name
CCKBR
Protein Name
Gastrin/cholecystokinin type B receptor
Gene Full Name
cholecystokinin B receptor
Synonyms
Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R; CCKBR; CCKRB
Uniprot ID
P32239
Entrez GeneID
887
Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 290,00 €
Preis: 290,00 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen