Antibodies

Anti-Human CCKBR DyLight 550 conjugated Antibody

Hersteller Boster
Kategorie
Typ Antibody Primary
Specific against other
Isotype IgG
Format Liquid
Applikationen FC
Menge 100ug/vial
Host Rabbit
ArtNr BOS-A01677-Dyl550
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Clonality
Polyclonal
Description short
Rabbit IgG Polyclonal Anti-Human CCKBR Antibody DyLight 550 Conjugated, Flow Validated.
Specificity
No cross reactivity with other proteins.
Reactivity
Reacts with: human
Application details
Flow Cytometry|1-3ug/1x106 cells
Notes
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence of human CCKBR (PVYTVVQPVGPRVLQCVHRWPSARVRQTWS).
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification
Immunogen affinity purified.
Storage
At 2-8C for one year. Protect from light. Do not freeze.
Background
The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Reference
1. Altar CA, Boyar WC (Apr 1989). "Brain CCK-B receptors mediate the suppression of dopamine release by cholecystokinin". Brain Research. 483 (2): 321–6.
2. Noble F, Roques BP (Jul 1999). "CCK-B receptor: chemistry, molecular biology, biochemistry and pharmacology". Progress in Neurobiology. 58 (4): 349–79.
Gene Name
CCKBR
Protein Name
Gastrin/cholecystokinin type B receptor
Gene Full Name
cholecystokinin B receptor
Synonyms
Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R; CCKBR; CCKRB
Uniprot ID
P32239
Entrez GeneID
887

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 290,00 €
Preis: 290,00 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen