Anti-YWHAE Antibody

Hersteller Boster
Kategorie
Typ Antibody
Specific against other
Applikationen WB, IHC
Menge 100ul
Host Rabbit
ArtNr BOS-A01687-2
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Gene name
YWHAE
Clonality
Polyclonal
Conjugate
No
Contents
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description
Rabbit Polyclonal antibody for YWHAE detection. Tested positive for IHC, WB in Human, Mouse, Rat
Uniprot ID
P62258
Immunogen
Synthetic peptide ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
Purification
Affinity Purified
Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application details
Dilution ratios see validation images
Reactivity
Human, Mouse, Rat
Menge: 100ul
Lieferbar: In stock
Listenpreis: 386,89 €
Preis: 386,89 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen