
Anti-MSX1 Antibody

Hersteller Boster
Typ Antibody
Specific against other
Applikationen WB, IHC
Menge 100ul
Host Rabbit
ArtNr BOS-A01701
eClass 6.1 32160702
eClass 9.0 32160702
Gene name
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Rabbit Polyclonal antibody for MSX1 detection. Tested positive for IHC, WB in Human, Mouse, Rat
Uniprot ID
The immunogen is a synthetic peptide directed towards the middle region of human MSX1 Synthetic peptide SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Protein A purified
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application details
Dilution ratios see validation images
Human, Mouse, Rat
Menge: 100ul
Lieferbar: In stock
Listenpreis: 386,89 €
Preis: 386,89 €


Angebot anfordern

Fragen zum Produkt?