
Anti-SLC1A2 Antibody

Hersteller Boster
Typ Antibody
Specific against other
Applikationen WB, IHC
Menge 100ul
Host Rabbit
ArtNr BOS-A01713
eClass 6.1 32160702
eClass 9.0 32160702
Gene name
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Rabbit Polyclonal antibody for SLC1A2 detection. Tested positive for IHC, WB in Human, Mouse, Rat
Uniprot ID
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2 Synthetic peptide PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
Affinity Purified
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application details
Dilution ratios see validation images
Human, Mouse, Rat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 100ul
Lieferbar: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Fragen zum Produkt?