Anti-Human CCR3 DyLight 488 conjugated Antibody

Hersteller Boster
Kategorie
Typ Antibody Primary
Specific against other
Isotype IgG
Format Liquid
Applikationen FC
Menge 100ug/vial
Host Rabbit
ArtNr BOS-A01748-Dyl488
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Clonality
Polyclonal
Description short
Rabbit IgG Polyclonal Anti-Human CCR3 Antibody DyLight 488 Conjugated, Flow Validated.
Specificity
No cross reactivity with other proteins.
Reactivity
Reacts with: human
Application details
Flow Cytometry|1-3ug/1x106 cells
Notes
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Purification
Immunogen affinity purified.
Storage
At 2-8C for one year. Protect from light. Do not freeze.
Background
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Reference
1. Blanchard, C., Wang, N., Stringer, K. F., Mishra, A., Fulkerson, P. C., Abonia, J. P., Jameson, S. C., Kirby, C., Konikoff, M. R., Collins, M. H., Cohen, M. B., Akers, R., Hogan, S. P., Assa'ad, A. H., Putnam, P. E., Aronow, B. J., Rothenberg, M. E. Eotaxin-3 and a uniquely conserved gene-expression profile in eosinophilic esophagitis. J. Clin. Invest. 116: 536-547, 2006.
2. Takeda, A., Baffi, J. Z., Kleinman, M. E., Cho, W. G., Nozaki, M., Yamada, K., Kaneko, H., Albuquerque, R. J. C., Dridi, S., Saito, K., Raisler, B. J., Budd, S. J., and 15 others. CCR3 is a target for age-related macular degeneration diagnosis and therapy. Nature 460: 225-230, 2009.
Gene Name
CCR3
Protein Name
C-C chemokine receptor type 3
Gene Full Name
chemokine (C-C motif) receptor 3
Synonyms
C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; Eosinophil eotaxin receptor; CD193; CCR3; CMKBR3
Uniprot ID
P51677
Entrez GeneID
1232
Menge: 100ug/vial
Lieferbar: In stock
Listenpreis: 290,00 €
Preis: 290,00 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen