Antibodies

Anti-SMARCA2 Antibody

Hersteller Boster
Kategorie
Typ Antibody
Specific against other
Applikationen WB, IHC
Menge 100ul
Host Rabbit
ArtNr BOS-A01888
eClass 6.1 32160702
eClass 9.0 32160702
Lieferbar
Gene name
SMARCA2
Clonality
Polyclonal
Conjugate
No
Contents
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description
Rabbit Polyclonal antibody for SMARCA2 detection. Tested positive for WB, IHC in Human, Mouse, Rat
Uniprot ID
P51531
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMARCA2 Synthetic peptide VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY
Purification
Affinity Purified
Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application details
Dilution ratios see validation images
Reactivity
Human, Mouse, Rat
Menge: 100ul
Lieferbar: In stock
Listenpreis: 386,89 €
Preis: 386,89 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen