Anti-Human CHRNA3 DyLight 550 conjugated Antibody

Kein Verkauf an Patienten, Ärzte, Apotheken oder Privatpersonen! Mehr erfahren

Hersteller Boster
Typ Antibody Primary
Specific against other
Isotype IgG
Format Liquid
Applikationen FC
Menge 100ug/vial
Host Rabbit
ArtNr BOS-A01981-Dyl550
eClass 6.1 32160702
eClass 9.0 32160702
Description short
Rabbit IgG Polyclonal Anti-Human CHRNA3 Antibody DyLight 550 Conjugated, Flow Validated.
No cross reactivity with other proteins.
Reacts with: human
Application details
Flow Cytometry|1-3ug/1x106 cells
Other applications have not been tested.
Optimal dilutions should be determined by end users.
A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Immunogen affinity purified.
At 2-8C for one year. Protect from light. Do not freeze.
Neuronal acetylcholine receptor subunit alpha-3, also known as nAChRalpha3, is a protein that in humans is encoded by the CHRNA3 gene. This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described.
1. "Entrez Gene: CHRNA3 cholinergic receptor, nicotinic, alpha 3".
2. Eng CM, Kozak CA, Beaudet AL, Zoghbi HY (Apr 1991). "Mapping of multiple subunits of the neuronal nicotinic acetylcholine receptor to chromosome 15 in man and chromosome 9 in mouse". Genomics. 9 (2): 278–82.
3. Mihovilovic M, Roses AD (1991). "Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor.". Exp. Neurol. 111 (2): 175–80.
Gene Name
Protein Name
Neuronal acetylcholine receptor subunit alpha-3
Gene Full Name
cholinergic receptor nicotinic alpha 3 subunit
Neuronal acetylcholine receptor subunit alpha-3; CHRNA3; NACHRA3
Uniprot ID
Entrez GeneID

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 100ug/vial
Lieferbar: In stock


Auf den Wunschzettel

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?