Recombinant Human FSH

Hersteller Cell Sciences
Kategorie
Typ Proteins
Specific against Human
Menge 2 ug
Host CHO cells
ArtNr CS-CRH208A
Eclass 6.1 34160400
Eclass 9.0 42020190
Lieferbar
Description
Recombinant Human Follicle Stimulating Hormone is a heterodimeric hormone consisting of a 92 amino acids alpha chain and a 111 amino acids beta chain.
Formulation
The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS.
Storage and Stability
It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MU-cm water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution FSH should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. Please prevent freeze-thaw cycles.
Source
CHO cells
Purity
Greater than 95% as determined by SDS-PAGE.
Protein Accession No
P01225
Biological Activity
The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
AA Sequence
FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Menge: 2 ug
Lieferbar: In stock
Listenpreis: 226,60 €
Preis: 226,60 €
lieferbar

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

 
Schließen