« Zurück
Home /
Recombinant Mouse Mesothelin(Msln),partial

Recombinant Mouse Mesothelin(Msln),partial

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Hepatic Cancer Uterine, Ovarian & Cervical Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP015044MO-50
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	Q61468
Gene Names	Msln
Organism	Mus musculus (Mouse)
AA Sequence	DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGT MLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYP ESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLK VSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGD IPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQ RHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASV KDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQ KLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLG LGLQGGIPNGYLVLDFNVREAFS
Expression Region	298-600aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	50.1 kDa
Alternative Name(s)	Pre-pro-megakaryocyte-potentiating factor
Relevance	Mbrane-anchored forms may play a role in cellular adhesion.
Reference	Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.Rump A., Morikawa Y., Tanaka M., Minami S., Umesaki N., Takeuchi M., Miyajima A.J. Biol. Chem. 279:9190-9198(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Membrane-anchored forms may play a role in cellular adhesion.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus, SUBCELLULAR LOCATION: Megakaryocyte-potentiating factor: Secreted
Protein Families	Mesothelin family
Tissue Specificity	Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level).
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen