Recombinant Human papillomavirus type 52 Protein E6(E6)

Hersteller Cusabio
Kategorie
Typ Proteins
Specific against other
Menge 200ug
Host E.coli
ArtNr CSB-EP334186HNY-200
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
AA Sequence
MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKK ELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFL SKISEYRHYQYSLYGKTLEERVKKPLSEITIRCII CQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECW RPRPVTQV
Research Topic
Others
Uniprot ID
P36814
Gene Names
E6
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-148aa
MW of Fusion Proten
33, 9
Sequence Info
Full Length
Relevance
Transcriptional transactivator. Binds double-stranded DNA .
Reference
Primer-directed sequencing of human papillomavirus types.Delius H., Hofmann B.Curr. Top. Microbiol. Immunol. 186:13-31(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Menge: 200ug
Lieferbar: In stock
Listenpreis: 546,07 €
Preis: 546,07 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen