« Zurück
Home /
Recombinant Escherichia coli Cytidylate kinase(cmk)

Recombinant Escherichia coli Cytidylate kinase(cmk)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP363865ENV-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Others
Uniprot ID	P0A6I0
Gene Names	cmk
Organism	Escherichia coli (strain K12)
AA Sequence	MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLD SGAIYRVLALAALHHHVDVASEDALVPLASHLDVR FVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAA FPRVREALLRRQRAFRELPGLIADGRDMGTVVFPD APVKIFLDASSEERAHRRMLQLQEKGFSVNFERLL AEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIE QVIEKALQYARQKLALA
Expression Region	1-227aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	40.7 kDa
Alternative Name(s)	Cytidine monophosphate kinase ; CMP kinaseProtein MssAp25
Relevance	ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Reference	Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Subcellular Location	Cytoplasm
Protein Families	Cytidylate kinase family, Type 1 subfamily
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP363865ENV-1-datasheet.pdf

CSB-EP363865ENV-1-safety-datasheet.pdf