Recombinant Escherichia coli Cytidylate kinase(cmk)

Hersteller Cusabio
Kategorie
Typ Proteins
Specific against other
Menge 1mg
Host E.coli
ArtNr CSB-EP363865ENV-1
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Research Topic
Others
Uniprot ID
P0A6I0
Gene Names
cmk
Organism
Escherichia coli (strain K12)
AA Sequence
MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLD SGAIYRVLALAALHHHVDVASEDALVPLASHLDVR FVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAA FPRVREALLRRQRAFRELPGLIADGRDMGTVVFPD APVKIFLDASSEERAHRRMLQLQEKGFSVNFERLL AEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIE QVIEKALQYARQKLALA
Expression Region
1-227aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
40.7 kDa
Alternative Name(s)
Cytidine monophosphate kinase ; CMP kinaseProtein MssAp25
Relevance
ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Reference
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
Subcellular Location
Cytoplasm
Protein Families
Cytidylate kinase family, Type 1 subfamily

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 1mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?