Recombinant Human Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial(SUCLG2),partial

Hersteller Cusabio
Kategorie Produkte / Proteins
Typ Proteins
Specific against Human
Menge 1mg
Host E.coli
ArtNr CSB-EP846636HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Lieferbar
Research Topic
Metabolism
Uniprot ID
Q96I99
Gene Names
SUCLG2
Organism
Homo sapiens (Human)
AA Sequence
MSDNGVRVQRFFVADTANEALEAAKRLNAKEIVLK AQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAK QMIGYNLATKQTPKEGVKVNKVMVAEALDISRETY LAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELI FKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAAD QITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDA KINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYD LKYIGLDGNIACFVNGAGLAMATCDIIFLNGGKPA NFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIF GGIVNCAIIANGITKACRELELKVPLVVRLEGTNV QEAQKILNNSGLPITSAIDLEDAAK
Expression Region
49-423aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
56.3 kDa
Alternative Name(s)
GTP-specific succinyl-CoA synthetase subunit beta; Succinyl-CoA synthetase beta-G chain ; SCS-betaG
Relevance
Catalyzes the GTP-dependent ligation of succinate and CoA to form succinyl-CoA.
Reference
Complete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Menge: 1mg
Lieferbar: In stock
Listenpreis: 1.246,43 €
Preis: 1.246,43 €
lieferbar

Angebot anfordern

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Schließen