Brain Natriuretic Peptide ( BNP ), Human

Hersteller GenScript
Kategorie
Typ Proteins
Specific against Human
Menge 100ug 
ArtNr Z02746-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Lieferbar
Product Line
Cytokine, Chemokines & Growth Factors
Description
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
M.W.
Approximately 3.5 kDa, a single non-glycosylated polypeptide chain containing 32 amino acids.
Purity
>97% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rHuBNP as determined by LAL method.
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2um filtered concentrated, solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Menge: 100ug 
Lieferbar: In stock
Listenpreis: 207,03 €
Preis: 207,03 €
lieferbar

Angebot anfordern

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Schließen