Comparison

Syndecan-4 Human Recombinant, His Tag

Item no. ANG-rAP-4900-10ug
Manufacturer Angio-Proteomie
Amount 10 ug
Quantity options 1000 ug 10 ug 1 ea 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SDC4, SYND4, SYND-4, Amphiglycan, Ryudocan core protein, Syndecan-4.
Shipping Condition Room temperature
Available
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa.
The SDC4 is purified by proprietary chromatographic techniques.
Amino Acid Sequence:MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLALEHHHHHH.
Physical Appearance and Stability: Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution SDC4 should be stored at 4C between 2-7 days and for future use below -18C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Formulation and Purity: The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized SDC4 in sterile 18MO-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close