Factor IX, Bovine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Bovine
Amount 0.25mg
Host Bovine
ArtNr PF35214
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
YNSGKLEEFVRGNLERECKEEKCSFEEAREVFENT EKTTEFWKQYVDGDQCESNPCLNGG MCKDDINSY ECWCQAGFEGTNCELDATCSIKNGRCKQFCKRDTD NKVVCSCTDGYRLAED QKSCEPAVPFPCGRVSVS HISKKLTRAETIFSNTNYENSSEAEIIWDNVTQSN QSFDEFS RVVGGEDAERGQFPWQVLLHGEIAAFC GGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTE K PEPTEQKRNVIRAIPYHSYNASINKYSHDIALLEL DEPLELNSYVTPICIADRDYTNIF SKFGYGYVSG WGKVFNRGRSASILQYLKVPLVDRATCLRSTKFSI YSHMFCAGYHEGGKD SCQGDSGGPHVTEVEGTSF LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTK LT
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
280688
Omim
300746
Swiss Prot
P00741
Unigene
Bt.13106
Molecular Weight
55 kDa
Amount: 0.25mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close