Plasmin, Bovine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Bovine
Amount 1mg
Host Bovine
ArtNr PP40031
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 100 mM Na phosphate, pH 7.3, with 1 mM 6-aminohexanoic acid and 25% glycerol
Sequence
MLPASPKMEHKAVVFLLLLFLKSGLGDLLDDYVNT QGASLLSLSRKNLAGRSVEDCAAKC EEETDFVCR AFQYHSKEQQCVVMAENSKNTPVFRMRDVILYEKR IYLLECKTGNGQTYRG TTAETKSGVTCQKWSATS PHVPKFSPEKFPLAGLEENYCRNPDNDENGPWCYT TDPDKRY DYCDIPECEDKCMHCSGENYEGKIAKT MSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNY C RNPDGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSS GPKYQCLKGTGKNYGGTVAVTESG HTCQRWSEQT PHKHNRTPENFPCKNLEENYCRNPNGEKAPWCYTT NSEVRWEYCTIPSCE SSPLSTERMDVPVPPEQTP VPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPH RHLKTP ENYPNAGLTMNYCRNPDADKSPWCYTTD PRVRWEFCNLKKCSETPEQVPAAPQAPGVENP PE ADCMIGTGKSYRGKKATTVAGVPCQEWAAQEPHQH SIFTPETNPQSGLERNYCRNPDG DVNGPWCYTMN PRKPFDYCDVPQCESSFDCGKPKVEPKKCSGRIVG GCVSKPHSWPWQVS LRRSSRHFCGGTLISPKWVL TAAHCLDNILALSFYKVILGAHNEKVREQSVQEIP VSRLF REPSQADIALLKLSRPAIITKEVIPACLP PPNYMVAARTECYITGWGETQGTFGEGLLKE AHL PVIENKVCNRNEYLDGRVKPTELCAGHLIGGTDSC QGDSGGPLVCFEKDKYILQGVT SWGLGCARPNKP GVYVRVSPYVPWIEETMRRN
Storage
-60C or below
Associated Disease
Cardiovascular
Entrez Gene
-
Omim
-
Molecular Weight
81 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close