Protein C, Bovine

Manufacturer Assaypro
Category
Type Proteins
Specific against Bovine
Amount 0.1mg
Host Bovine
Item no. PP51031
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
XTSLLLFVTIWGISSTPAPPDSVFSSSQRAHQVLR IRKRANSFLEELRPGNVERECSEEV CEFEEAREI FQNTEDTMAFWSFYSDGDQCEDRPSGSPCDLPCCG RGKCIDGLGGFRCDCA EGWEGRFCLHEVRFSNCS AENGGCAHYCMEEEGRRHCSCAPGYRLEDDHQLCV SKVTFPC GRLGKRMEKKRKTLKRDTNQVDQKDQL DPRIVDGQEAGWGESPWQAVLLDSKKKLVCGAV L IHVSWVLTVAHCLDSRKKLIVRLGEYDMRRWESWE VDLDIKEVIIHPNYTKSTSDNDIA LLRLAKPATL SQTIVPICLPDSGLSERKLTQVGQETVVTGWGYRD ETKRNRTFVLSFIKV PVVPYNACVHAMENKISEN MLCAGILGDPRDACEGDSGGPMVTFFRGTWFLVGL VSWGEG CGRLYNYGVYTKVSRYLDWIYGHIKAQE APLESQVP
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
-
Omim
-
Molecular Weight
52 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close