Prothrombin, Bovine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Bovine
Amount 1mg
Host Bovine
ArtNr PP52104
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ pH 7.4
Sequence
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQAS SLLQRARRANKGFLEEVRKGNLERE CLEEPCSRE EAFEALESLSATDAFWAKYTACESARNPREKLNEC LEGNCAEGVGMNYRGN VSVTRSGIECQLWRSRYP HKPEINSTTHPGADLRENFCRNPDGSITGPWCYTT SPTLRRE ECSVPVCGQDRVTVEVIPRSGGSTTSQ SPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS E QAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCY VADQPGDFEYCDLNYCEEPVDGDL GDRLGEDPDP DAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLF EKKQVQDQTEKELFE SYIEGRIVEGQDAEVGLSP WQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYP PWDKNF TVDDLLVRIGKHSRTRYERKVEKISMLD KIYIHPRYNWKENLDRDIALLKLKRPIELSDY IH PVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTS VAEVQPSVLQVVNLPLVERPVCK ASTRIRITDNM FCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWY QMGIVSWGEGCDRD GKYGFYTHVFRLKKWIQKVI DRLGS
Storage
-60C or below
Associated Disease
Alzheimer's Disease, Blood Disorder, Sepsis, Chronic Gastrointestinal Disorder
Entrez Gene
280685
Omim
176930
Swiss Prot
P00735
Unigene
Bt.29855
Molecular Weight
71 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close