Azurocidin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PA30011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized, salt free
Sequence
MTRLTVLALLAGLLASSRAGSSPLLDIVGGRKARP RQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQ SQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSEN GYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQN ATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVT PEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGL AHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNN PGPGPA
Storage
-60C or below
Associated Disease
Immunology, Cardiovascular
Entrez Gene
566
Omim
162815
Swiss Prot
P20160
Unigene
Hs. 72885
Molecular Weight
53 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close