Antithrombin III, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PA50031
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M sodium
citrate/ 0.15 M NaCl/ pH 8.3
Sequence
MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGS PVDICTAKPRDIPMN PMCIYRSPEKKATEDEGSE QKIPEATNRRVWELSKANSRFATTFYQHLAD SKN DNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVF KFDTISEKTSDQ IHFFFAKLNCRLYRKANKSSKL VSANRLFGDKSLTFNETYQDISELVYGA KLQPLD FKENAEQSRAAINKWVSNKTEGRITDVIPSEAINE LTVLVLVNT IYFKGLWKSKFSPENTRKELFYKAD GESCSASMMYQEGKFRYRRVAEGTQ VLELPFKGD DITMVLILPKPEKSLAKVEKELTPEVLQEWLDELE EMMLVV HMPRFRIEDGFSLKEQLQDMGLVDLFSP EKSKLPGIVAEGRDDLYVSDAF HKAFLEVNEEGS EAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREV PLN TIIFMGRVANPCVK
Storage
-60C or below
Associated Disease
Cardiovascular
Entrez Gene
462
Omim
107300
Swiss Prot
P01008
Unigene
Hs.75599
Molecular Weight
58 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close