Alpha 1 Antichymotrypsin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PA60041
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 20 mM Tris-HCl, pH 7.4, with 150 mM NaCl
Sequence
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLT QENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKF NLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAA AKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS LHHLTIPYFRDEELSCTVVELKYTGNASALFILPD QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPK FSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSA LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP KQA
Storage
-60C or below
Associated Disease
Alzheimer's Disease, Cardiovascular Disorder
Entrez Gene
12
Omim
107280
Swiss Prot
P01011
Unigene
Hs.534293, Hs.710488
Molecular Weight
64 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close