Alpha 1 Antitrypsin, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 1mg
Host Human
Item no. PA60051
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 30 mM sodium phosphate, pH 6.5, with 300 mM sodium chloride
Sequence
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLT QENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKF NLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAA AKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS LHHLTIPYFRDEELSCTVVELKYTGNASALFILPD QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPK FSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSA LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP KQA
Storage
-60C or below
Associated Disease
Cardiovascular, Cancer, Hypoxia
Entrez Gene
5265
Omim
107400
Swiss Prot
P01009
Unigene
Hs.525557
Molecular Weight
52 kDa

Instruction sheet

PA60051.pdf

Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de