Alpha-2-HS-Glycoprotein, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PA60111
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 20 mM Tris-HCl, pH 8.0, with 200 mM NaCl
Sequence
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDP ETEEAALVAIDYINQNLPWGYKHTL NQIDEVKVW PQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQ LKEHAVEGDCDFQLLK LDGKFSVVYAKCDSSPDS AEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNA QNNGSNF QLEEISRAQLVPLPPSTYVEFTVSGTD CVAKEATEAAKCNLLAEKQYGFCKATLSEKLGG A EVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPD APPSPPLGAPGLPPAGSPPDSHVL LAAPPGHQLH RAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQP SVGAAAGPVVPPCPG RIRHFKV
Storage
-60C or below
Associated Disease
Cardiovascular, Kidney Failure, Alzheimer's Disease
Entrez Gene
197
Omim
138680
Swiss Prot
P02765
Unigene
Hs.324746
Molecular Weight
49 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close