Alpha 2 Antiplasmin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PA65398
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.15 M NaCl/ pH 7.4
Sequence
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLT QENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKF NLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAA AKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS LHHLTIPYFRDEELSCTVVELKYTGNASALFILPD QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPK FSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSA LVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP KQA
Storage
-60C or below
Associated Disease
Cardiovascular, Blood Disorder
Entrez Gene
5345
Omim
613168
Swiss Prot
P08697
Unigene
Hs.159509
Molecular Weight
70 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close