Complement C4, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PC52122
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Sodium Phosphate buffer pH 7.0 containing 0.15M NaCl
Sequence
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGV PLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSP KVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRG PEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGH LFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTIT VMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEP GTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKI TPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVA YVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLS KAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGG EMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFL LQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHP AIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLN LNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRT LTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRV DVQAGACEGKLELSVDGAKQYRNGESVKLHLETDS LALVALGALDTALYAAGSKSHKPLNMGKVFEAMNS YDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRK RLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAK RCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSC CQFAESLRKKSRDKGQAGLQRALEILQEEDLIDED DIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTT WEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGL CLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVS LKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELV YELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRV TASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTM IYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQ KGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKV LSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDP CPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAV FQDEGAEPLKQRVEASISKANSFLGEKASAGLLGA HAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETG DNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSF QGGFRSTQDTVIALDALSAYWIASHTTEERGLNVT LSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSK INVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIE VTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPL QPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTV CIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLT SLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEA VQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSK SRLLATLCSAEVCQCAEGKCPRQRRALERGLQDED GYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFET KITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSE RLCRSTRQRAACAQLNDFLQEYGTQGCQV
Storage
-60C or below
Associated Disease
Lupus (SLE), Autoimmune Disease
Entrez Gene
720, 721
Omim
120810, 120820
Swiss Prot
P0C0L4, P0C0L5
Unigene
Hs.534847, Hs.720022
Molecular Weight
205 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close