Ceruloplasmin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PC70011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 50 mM potassium phosphate, pH 6.8, 100 mM KCl and 20 mM E-amino caproic acid + 5 mM EDTA.
Sequence
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDY ASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKA LYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKV YVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTT DFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCV TRIYHSHIDAPKDIASGLIGPLIICKKDSLDKEKE KHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEK VDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDR VKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTIN LFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQA FFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNY APSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWA EVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTY YSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEV GPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKIC KKGSLHANGRQKDVDKEFYLFPTVFDENESLLLED NIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGN QPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTY LWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYY IAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDK GEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHL GILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACI PWAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNP RRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKV NKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEV NWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDV FDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM ETTYTVLQNEDTKSG
Storage
-60C or below
Associated Disease
Cardiovascular, Blood Disorder
Entrez Gene
1356
Omim
117700
Swiss Prot
P00450
Unigene
Hs.558314
Molecular Weight
132 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close