Factor V, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 50ug
Host Human
ArtNr PF100511
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFY VAAQGISWSYRPEPTNSSLNLSVTS FKKIVYREY EPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKN KADKPLSIHPQGIRYS KLSEGASYLDHTFPAEKM DDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYY SHENLIE DFNSGLIGPLLICKKGTLTEGGTQKTF DKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG T MPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVL EQNHHKVSAITLVSATSTTANMTV GPEGKWIISS LTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRR HMKRWEYFIAAEEVI WDYAPVIPANMDKKYRSQH LDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMK EDGILG PIIRAQVRDTLKIVFKNMASRPYSIYPH GVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET YT YKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIAS GLIGLLLICKSRSLDRRGIQRAA DIEQQAVFAVF DENKSWYLEDNINKFCENPDEVKRDDPKFYESNIM STINGYVPESITTL GFCFDDTVQWHFCSVGTQNE ILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTM DNVGT WMLTSMNSSPRSKKLRLKFRDVKCIPDDD EDSYEIFEPPESTVMATRKMHDRLEPEDEES DAD YDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALAL ENGTEFVSSNTDIIVGSNYSSP SNISKFTVNNLA EPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEH SSPYSEDPIEDPL QPDVTGIRLLSLGAGEFKSQE HAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQ DTGS PSGMRPWEDLPSQDTGSPSRMRPWKDPPSD LLLLKQSNSSKILVGRWHLASEKGSYEIIQ DTDE DTAVNNWLISPQNASRAWGESTPLANKPGKQSGHP KFPRVRHKSLQVRQDGGKSRL KKSQFLIKTRKKK KEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSL VLHKSNETSLPT DLNQTLPSMDFGWIASLPDHNQ NSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQ MHS TSDPSHRSSSPELSEMLEYDRSHKSFPTDIS QMSPSSEHEVWQTVISPDLSQVTLSPELS QTNLS PDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTL SPDLSHTTLSLDLSQTNLSP ELSQTNLSPALGQM PLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQ TNLSPALGQMP ISPDLSHTTLSLDFSQTNLSPEL SQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPE LS QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLS PDLGETDLSPNFGQMSLSPDLSQVTLSP DISDTT LLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNES FPYPDLGQMPSPSSPTLND TFLSKEFNPLVIVGL SKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPY KTDVRTNINS SRDPDNIAAWYLRSNNGNRRNYYI AAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVV F RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVD DVIQVRFKNLASRPYSLHAHGLSYEKS SEGKTYE DDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPG SACRAWAYYSAVNPEKDI HSGLIGPLLICQKGIL HKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSS WRLTSSEMK KSHEFHAINGMIYSLPGLKMYEQEW VRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRA GMQTPFLIMDRDCRMPMGLSTGIISD SQIKASEF LGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWI QVDMQKEVIITGIQTQG AKHYLKSCYTTEFYVAY SSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQF DPPIVARY IRISPTRAYNRPTLRLELQGCEVNGC STPLGMENGKIENKQITASSFKKSWWGDYWEPFR ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITA IITQGCKSLSSEMYVKSYTIHYSEQ GVEWKPYRL KSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVI PKTWNQSIALRLELFG CDIY
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2153
Omim
612309
Swiss Prot
P12259
Unigene
Hs.30054
Molecular Weight
252 kDa
Amount: 50ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close