Factor IXa, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 0.25mg
Host Human
Item no. PF10097
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHE NANKILNRPKRYNSGKLEEFVQGNLERECMEEKCS FEEAREVFENTERTTEFWKQYVDGDQCESNPCLNG GSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGR CEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVP FPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETI LDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLN GKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG EHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHD IALLELDEPLVLNSYVTPICIADKEYTNIFLKFGS GYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRS TKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIK EKTKLT
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2158
Omim
300746
Swiss Prot
P00740
Unigene
Hs.522798
Molecular Weight
45 kDa
Amount: 0.25mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close