Factor XIa, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PF10105
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
4 mM Sodium Acetate-HCl/ 0.15 M
NaCl/ pH 5.3
Sequence
Heavy Chain - ECVTQLLKDTCFEGGDITTVF TPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWF TCVL KDSVTETLPRVNRTAAISGYSFKQCSHQIS ACNKDIYVDLDMKGINYNSSVAKSAQECQE RCTD DVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTR ITKLDKVVSGFSLKSCALSNL ACIRDIFPNTVFA DSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEW PKESQRNLCLLK TSESGLPSTRIKKSKALSGFSL QSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHE ACQ KLCTNAVRCQFFTYTPAQASCNEGKGKCYLK LSSNGSPTKILHGRGGISGYTLRLCKMDN ECTTK IKPR Light Chain - IVGGTASVRGEWPWQV TLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVES PKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQY KMAESGYDIALLKLETTVNYTDSQRPICLPSKGDR NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVT NEECQKRYRGHKITHKMICAGYREGG KDACKGDS GGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTN VVEYVDWILEKTQAV
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2160
Omim
264900
Swiss Prot
P03951
Unigene
Hs.1430
Molecular Weight
160 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close