Factor XIII, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PF10107
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
50 mM Tris/ 100 mM NaCl/ 1 mM
EDTA/ 10 u/mL aprotinin/ 20%
glycerol/ pH 7.5
Sequence
A Chain - MSETSRTAFGGRRAVPPNNSNAAED DLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYD PRRDLFRVEYVIGRYPQENKGTYIPV PIVSELQS GKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVA VWTPYGVLRTSRNPETD TYILFNPWCEDDAVYLD NEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFE DGILDTCL YVMDRAQMDLSGRGNPIKVSRVGSAM VNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARI VTNYFSAHDNDANLQMDIFLEEDGN VNSKLTKDS VWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENS DGMYRCGPASVQAIKH GHVCFQFDAPFVFAEVNS DLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGD GMMDITD TYKFQEGQEEERLALETALMYGAKKPL NTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF R NNSHNRYTITAYLSANITFYTGVPKAEFKKETFDV TLEPLSFKKEAVLIQAGEYMGQLL EQASLHFFVT ARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGS DMTVTVQFTNPLKET LRNVWVHLDGPGVTRPMKK MFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDS LRHVYG ELDVQIQRRPSM B Chain - MRLKN LTFIIILIISGELYAEEKPCGFPHVENGRIAQYYY TFKSFYFPMSIDKKLSFFCL AGYTTESGRQEEQT TCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYK IQENMRYGCAS GYKTTGGKDEEVVQCLSDGWSSQ PTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQY EC ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLK CSSLRLIENGYFHPVKQTYEEGDVVQFF CHENYY LSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPI NSKIQTHSTTYRHGEIVHI ECELNFEIHGSAEIR CEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLH SKIYYNGDKV TYACKSGYLLHGSNEITCNRGKWT LPPECVENNENCKHPPVVMNGAVADGILASYATGS S VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEP CTVNVDYMNRNNIEMKWKYEGKVLHGD LIDFVCK QGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKG MCTSPPLIKHGVIISSTV DTYENGSSVEYRCFDH HFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEK NNLLLKWDF DNRPHILHGEYIEFICRGDTYPAEL YITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLR T
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2165
Omim
134580
Swiss Prot
P05160
Unigene
Hs.435782
Molecular Weight
320 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close