Factor VII, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PF25410
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDM PWKPGPHRVFVTQEEAHGVLHRRRR ANAFLEELR PGSLERECKEEQCSFEEAREIFKDAERTKLFWISY SDGDQCASSPCQNGGS CKDQLQSYICFCLPAFEG RNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCR CHEGYSL LADGVSCTPTVEYPCGKIPILEKRNAS KPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGG T LINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEH DGDEQSRRVAQVIIPSTYVPGTTN HDIALLRLHQ PVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWG QLLDRGATALELMVL NVPRLMTQDCLQQSRKVGD SPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRG TWYLTG IVSWGQGCATVGHFGVYTRVSQYIEWLQ KLMRSEPRPGVLLRAPFP
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
2155
Omim
6138785
Swiss Prot
P08709
Unigene
Hs.36989
Molecular Weight
52 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close