GPIIbIIIa, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.5mg
Host Human
ArtNr PG52412
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 0.1%
Triton X-100/ 1 mM CaCI2/ 0.05%
NaN3/ 50% glycerol/ pH 7.4
Sequence
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLD PVQLTFYAGPNGSQFGFSLDFHKDS HGRVAIVVG APRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLR DETRNVGSQTLQTFKA RQGLGASVVSWSDVIVAC APWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAE YSPCRGN TLSRIYVENDFSWDKRYCEAGFSSVVT QAGELVLGAPGGYYFLGLLAQAPVADIFSSYRP G ILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFD GDLNTTEYVVGAPTWSWTLGAVEI LDSYYQRLHR LRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYM ESRADRKLAEVGRVY LFLQPRGPHALGAPSLLLT GTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGP SGRGQV LVFLGQSEGLRSRPSQVLDSPFPTGSAF GFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR AQ PVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFN IQMCVGATGHNIPQKLSLNAELQ LDRQKPRQGRR VLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDE ADFRDKLSPIVLSL NVSLPPTEAGMAPAVVLHGD THVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLL VGADN VLELQMDAANEGEGAYEAELAVHLPQGAH YMRALSNVEGFERLICNQKKENETRVVLCEL GNP MKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKN SQNPNSKIVLLDVPVRAEAQVE LRGNSFPASLVV AAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNG LHLSIHLPGQSQP SDLLYILDIQPQGGLQCFPQP PVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPE PEQP SRLQDPVLVSCDSAPCTVVQCDLQEMARGQ RAMVTVLAFLWLPSLYQRPLDQFVLQSHAW FNVS SLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWW VLVGVLGGLLLLTILVLAMWK VGFFKRNRPPLEE DDEEGE
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
3674, 3690
Omim
607759, 173470
Swiss Prot
P05106, P08514
Unigene
Hs.411312, Hs.218040
Molecular Weight
113 kDa
Amount: 0.5mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close