Hemopexin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.5mg
Host Human
ArtNr PH30021
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized, salt free
Sequence
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNV AEGETKPDPDVTERCSDGWSFDATT LDDNGTMLF FKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQG HNSVFLIKGDKVWVYP PEKKEKGYPKLLQDEFPG IPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLA TGTMKER SWPAVGNCSSALRWLGRYYCFQGNQFL RFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN G TGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYA FSGTHYWRLDTSRDGWHSWPIAHQ WPQGPSAVDA AFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRL EKEVGTPHGIILDSV DAAFICPGSSRLHIMAGRR LWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLG PNSCSA NGPGLYLIHGPNLYCYSDVEKLNAAKAL PQPQNVTSLLGCTH
Storage
-60C or below
Associated Disease
Liver Disease
Entrez Gene
3263
Omim
142290
Swiss Prot
P02790
Unigene
Hs.426485
Molecular Weight
57 kDa
Amount: 0.5mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close