Immunoglobulin D, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PI50014
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 10 mM Tris-HCl, pH 8.0, with 10 mM EACA, 150 mM NaCl and 0.05% NaN3
Sequence
APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHP TSVTVTWYMGTQSQPQRTFPEIQRR DSYYMTSSQ LSTPLQQWRQGEYKCVVQHTASKSKKEIFRWPESP KAQASSVPTAQPQAEG SLAKATTAPATTRNTGRG GEEKKKEKEKEEQEERETKTPECPSHTQPLGVYLL TPAVQDL WLRDKATFTCFVVGSDLKDAHLTWEVA GKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSL W NAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLS LNLLASSDPPEAASWLLCEVSGFS PPNILLMWLE DQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAP PSPQPATYTCVVSHE DSRTLLNASRSLEVSYVTD HGPMK
Storage
-60C or below
Associated Disease
AIDS, Tuberculosis, Infectious Hepatitis, and Respiratory Disease
Entrez Gene
3495
Omim
147170
Swiss Prot
P01880
Unigene
Hs.510635
Molecular Weight
185 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close