Immunoglobulin E, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PI50015
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 15 mM potassium phosphate, pH 7.4, with 150 mM NaCl and 0.05% NaN3
Sequence
ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYF PEPVMVTWDTGSLNGTTMTLPATTLTLSGHYATIS LLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVC SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGY TPGTINITWLEDGQVMDVDLSTASTTQEGELASTQ SELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCA DSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLA PSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTV TSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTT KTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNF MPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFF VFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR AVSVNPGK
Storage
-60C or below
Associated Disease
Lupus (SLE), Autoimmune Disease
Entrez Gene
3497
Omim
147180
Swiss Prot
P01854
Molecular Weight
200 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close