Immunoglobulin G3, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PI50018
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 20 mM phosphate, pH 7.4, with 150 mM NaCl and 0.05% NaN3
Sequence
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVV TVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPL GDTTHTCPRCPEPKSC DTPPPCPRCPEPKSCDTP PPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLF PPKPKDT LMISRTPEVTCVVVDVSHEDPEVQFKW YVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLH Q DWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREP QVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVE WESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKS RWQQGNIFSCSVMHE ALHNRFTQKSLSLSPGK
Storage
-60C or below
Associated Disease
Viral Hepatitis, Autoimmune Hepatitis, Cirrhosis
Entrez Gene
3502
Omim
147120
Swiss Prot
P01860
Unigene
Hs.510635
Molecular Weight
170 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close