Immunoglobulin M, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PI50022
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 50 mM Tris-HCl, pH 8.0, with 200 mM NaCl and 0.05% NaN3
Sequence
GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLP DSITLSWKYKNNSDISSTRGFPSVL RGGKYAATS QVLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLP VIAELPPKVSVFVPPR DGFFGNPRKSKLICQATG FSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGP TTYKVTS TLTIKESDWLGQSMFTCRVDHRGLTFQ QNASSMCVPDQDTAIRVFAIPPSFASIFLTKST K LTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISES HPNATFSAVGEASICEDDWNSGER FTCTVTHTDL PSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRE SATITCLVTGFSPAD VFVQWMQRGQPLSPEKYVT SAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCV AHEALP NRVTERTVDKSTGKPTLYNVSLVMSDTA GTCY
Storage
-60C or below
Associated Disease
Hepatitis, Infectious Disease
Entrez Gene
3507
Omim
147020
Swiss Prot
P01871
Unigene
Hs.510635
Molecular Weight
950 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close