Kininogen (HMW), Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 100ug
Host Human
ArtNr PK20011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 10 mM Na acetate, pH 5.5, with 250 mM NaCl
Sequence
MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFK AVDAALKKYNSQNQSNNQFVLYRIT EATKTVGSD TFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAAT GECTATVGKRSSTKFS VATQTCQITPAEGPVVTA QYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQH SSLFMLN EVKRAQRQVVAGLNFRITYSIVQTNCS KENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR I ASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSP ELEETLTHTITKLNAENNATFYFK IDNVKKARVQ VVAGKKYFIDFVARETTCSKESNEELTESCETKKL GQSLDCNAEVYVVPW EKKIYPTVNCQPLGMISLM KRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQD EERDSG KEQGHTRRHDWGHEKQRKHNLGHGHKHE RDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLD DD LEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHN GWKTEHLASSSEDSTTPSAQTQE KTEGPTPIPSL AKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDD WIPDIQIDPNGLSF NPISDFPDTTSPKCPGRPWK SVSEINPTTQMKESYYFDLTDGLS
Storage
-60C or below
Associated Disease
Abnormal Surface Mediated Activation of Fibrinolysis
Entrez Gene
3827
Omim
612358
Swiss Prot
P01042
Unigene
Hs.77741
Molecular Weight
120 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close