Lysozyme, Human

Manufacturer Assaypro
Category
Type Proteins
Specific against Human
Amount 100ug
Host Human
Item no. PL50071
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized from 50 mM Na acetate, pH 6.0 with 100 mM NaCl
Sequence
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGM DGYRGISLANWMCLAKWESGYNTRA TNYNAGDRS TDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQ DNIADAVACAKRVVRD PQGIRAWVAWRNRCQNRD VRQYVQGCGV
Storage
-60C or below
Associated Disease
Cancer
Entrez Gene
4069
Omim
153450
Swiss Prot
P61626
Unigene
Hs.524579
Molecular Weight
17 kDa
Amount: 100ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close