Protein S, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.1mg
Host Human
ArtNr PP85412
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-Page
Presentation
20 mM Tris-HCl/ 0.1 M NaCl/ 1mM
Benzamidine/ pH 7.4
Sequence
MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQV LVRKRRANSLLEETKQGNLERECIE ELCNKEEAR EVFENDPETDYFYPKYLVCLRSFQTGLFTAARQST NAYPDLRSCVNAIPDQ CSPLPCNEDGYMSCKDGK ASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQ ICDNTPG SYHCSCKNGFVMLSNKKDCKDVDECSL KPSICGTAVCKNIPGDFECECPEGYRYNLKSKS C EDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLA QDQKSCEVVSVCLPLNLDTKYELL YLAEQFAGVV LYLKFRLPEISRFSAEFDFRTYDSEGVILYAESID HSAWLLIALRGGKIE VQLKNEHTSKITTGGDVIN NGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLF KPENGL LETKVYFAGFPRKVESELIKPINPRLDG CIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE KG SYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPS TGTGVMLALVSGNNTVPFAVSLV DSTSEKSQDIL LSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLEL STPLKIETISHEDL QRQLAVLDKAMKAKVATYLG GLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAI SKHND IRAHSCPSVWKKTKNS
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
5627
Omim
176880
Swiss Prot
P07225
Unigene
Hs.64016
Molecular Weight
75 kDa
Amount: 0.1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close